PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g45165.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 128aa    MW: 14741.1 Da    PI: 8.5008
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g45165.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.64.5e-274090252
            RWP-RK  2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                      ek ++++ +s+yF+lpi +AA+eL+v+lT+LK++CR +GI+RWPhRk++sl
  Bradi1g45165.1.p 40 EKVLTFKLVSRYFHLPIVQAARELNVGLTILKKKCRDLGIPRWPHRKMNSL 90
                      7889*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.37126110IPR003035RWP-RK domain
PfamPF020423.4E-214390IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016554Biological Processcytidine to uridine editing
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MEQSESKREE SEKGLPIICC SDEIGAAFHT KRGDRVRPEE KVLTFKLVSR YFHLPIVQAA  60
RELNVGLTIL KKKCRDLGIP RWPHRKMNSL QNLINNVEVL KEAGKTNDDE QLKAMVEMLE  120
QERRLLE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751743.17e-90PREDICTED: protein RKD1
SwissprotQ9M9U92e-26RKD1_ARATH; Protein RKD1
TrEMBLI1GZJ52e-82I1GZJ5_BRADI; Uncharacterized protein
STRINGBRADI1G45170.14e-82(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Representative plantOGRP5671777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.16e-28RWP-RK domain-containing protein